PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19414.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 301aa    MW: 34513.1 Da    PI: 5.7654
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19414.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding408.8e-131055146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W+ +Ede l++ v ++G++ W++I ++  + Rt+k+c++rw +
       KHN19414.1 10 KGPWSSDEDEVLLRHVSKYGPREWSSIRSKGLLSRTGKSCRLRWVN 55
                     79*************************888779***********87 PP

2Myb_DNA-binding47.54e-1566106345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T+eE+ l v++ +q+G++ W++Ia +++ gRt++++k++w 
       KHN19414.1  66 KFTAEEERLVVELQAQFGNK-WAKIATYLQ-GRTDNDVKNFWS 106
                      79******************.*********.***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.563157IPR017930Myb domain
SuperFamilySSF466891.4E-287105IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-20758IPR009057Homeodomain-like
SMARTSM007172.0E-11959IPR001005SANT/Myb domain
PfamPF002493.2E-111055IPR001005SANT/Myb domain
CDDcd001679.03E-111257No hitNo description
PROSITE profilePS5129421.57858113IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-1859111IPR009057Homeodomain-like
SMARTSM007173.1E-1263111IPR001005SANT/Myb domain
PfamPF002492.9E-1366106IPR001005SANT/Myb domain
CDDcd001679.21E-1166105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MERELLEIKK GPWSSDEDEV LLRHVSKYGP REWSSIRSKG LLSRTGKSCR LRWVNKLRPN  60
LKTGCKFTAE EERLVVELQA QFGNKWAKIA TYLQGRTDND VKNFWSSRRK RLERMLQKPP  120
TSKPHKNNGK THINQVEEMV PPCSSNQVEE ILSYSTSYMG NTQVFEMINL PDLIKPNYQQ  180
LENDYLSAVE VEATPLHTVP SFESSLGYNF PLLPEPDPLM DCPLFPECQD LVPEPFDPIF  240
VDGFKEKKCS ECVCSSQKLG TRLPTFGLEG NSQSASSNGF FKDFPSEIFE YFEHIPTSSD  300
Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-28711124126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006593308.10.0PREDICTED: myb-related protein 340-like
TrEMBLA0A0B2QGR70.0A0A0B2QGR7_GLYSO; Transcription factor GAMYB
TrEMBLK7LWP50.0K7LWP5_SOYBN; Uncharacterized protein
STRINGGLYMA12G37026.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.12e-68MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]